Transcription factor Sp4 (SP4) Rabbit Polyclonal Antibody TA335786 from OriGene Technologies | Biocompare.com

Supplier Images

Transcription factor Sp4 (SP4) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Transcription factor Sp4 (SP4) Rabbit Polyclonal Antibody

OriGene Technologies' Transcription factor Sp4 (SP4) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunohistochemistry, and Western Blot. The Transcription factor Sp4 (SP4) Rabbit Polyclonal Antibody was generated using Sp4 as the antigen and it reacts with Human.

Description

Rabbit Polyclonal Anti-SP4 Antibody

Product Specs
ItemTranscription factor Sp4 (SP4) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA335786
Quantity100 µl
ApplicationsIHC, WB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetSP4
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-SP4 Antibody: synthetic peptide directed towards the middle region of human SP4. Synthetic peptide located within the following region: GGTALAIVTSGELDSSVTEVLGSPRIVTVAAISQDSNPATPNVSTNMEEF
NCBI Full Gene NameSp4 transcription factor
NCBI Gene AliasesSPR-1, HF1B
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!